Tmlhe Antibody - C-terminal region : Biotin

Tmlhe Antibody - C-terminal region : Biotin
SKU
AVIARP57146_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Tmlhe is a first enzyme in the carnitine biosynthesis pathway and plays an important role in the transport of fatty acids across the inner mitochondrial membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tmlhe

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trimethyllysine dioxygenase, mitochondrial

Protein Size: 433

Purification: Affinity Purified
More Information
SKU AVIARP57146_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57146_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 170898
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×