TMOD2 Antibody - N-terminal region : Biotin

TMOD2 Antibody - N-terminal region : Biotin
SKU
AVIARP55079_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMOD2

Key Reference: Pawlak,G., (2004) Int. J. Cancer 110 (3), 368-373

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDRED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tropomodulin-2

Protein Size: 351

Purification: Affinity Purified
More Information
SKU AVIARP55079_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55079_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29767
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×