TMOD3 Antibody - middle region : FITC

TMOD3 Antibody - middle region : FITC
SKU
AVIARP55078_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMOD3

Key Reference: Weber,K.L., J. Cell. Sci. 120 (PT 20), 3625-3632 (2007)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tropomodulin-3

Protein Size: 352

Purification: Affinity Purified
More Information
SKU AVIARP55078_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55078_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29766
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×