TRAPPC2L Antibody - N-terminal region : HRP

TRAPPC2L Antibody - N-terminal region : HRP
SKU
AVIARP56852_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRAPPC2L

Key Reference: Rual,J.F., (2005) Nature 437 (7062), 1173-1178

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Trafficking protein particle complex subunit 2-like protein

Protein Size: 140

Purification: Affinity Purified

Subunit: 2-like protein
More Information
SKU AVIARP56852_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56852_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51693
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×