TRIM58 Antibody - middle region : HRP

TRIM58 Antibody - middle region : HRP
SKU
AVIARP57993_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM58

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: FNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tripartite motif-containing protein 58

Protein Size: 486

Purification: Affinity Purified
More Information
SKU AVIARP57993_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57993_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25893
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×