Tspan4 Antibody

Uniprot: O14817

Gene Name: TSPAN4

Immunogen: Recombinant human TSPAN4

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 99%

Core Sequence: IDSYAQQDLKKGLHLYGTEGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSDSCGLHEPGTWWKSPCYETVKAWLQE

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 33%, Pig - 92%, Cynomolgus monkey - 93%

Alternative gene names: NAG2；TM4SF7

Alternative protein names: Tetraspanin-4; Tspan-4; Novel antigen 2; NAG-2; Transmembrane 4 superfamily member 7

Protein name: Tetraspanin 4

Clone No.: KAA338_8H11

Antigen Species: Human

Target Name: Tspan4

IHC Verification: succeed

IHC Dilution: 1:200

WB Verification: -

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: P10163PAGN

Cross reactivity: Not tested

• SKU: ASBKC-1909-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: KC-1909-100
• Package Unit: 100 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunohistochemistry, Immunocytochemistry
• Isotype: IgG1
• Human Gene ID: 7106
• Host: Mouse
• Conjugate: Unconjugated