TSSK2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSSK2

Key Reference: Hao,Z., (2004) Mol. Hum. Reprod. 10 (6), 433-444

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-specific serine/threonine-protein kinase 2

Protein Size: 358

Purification: Affinity Purified

• SKU: AVIARP53818_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53818_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23617
• Host: Rabbit
• Conjugate: Conjugated, FITC