TSSK2 Antibody - middle region : FITC

TSSK2 Antibody - middle region : FITC
SKU
AVIARP53819_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSSK2

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: DHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISGAEVGKAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-specific serine/threonine-protein kinase 2

Protein Size: 358

Purification: Affinity Purified
More Information
SKU AVIARP53819_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53819_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23617
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×