TSSK2 Antibody - middle region : HRP

TSSK2 Antibody - middle region : HRP
SKU
AVIARP53818_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSSK2

Key Reference: Hao,Z., (2004) Mol. Hum. Reprod. 10 (6), 433-444

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Testis-specific serine/threonine-protein kinase 2

Protein Size: 358

Purification: Affinity Purified
More Information
SKU AVIARP53818_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53818_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23617
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×