TUBA3E Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. This gene encodes an alpha tubulin that highly conserved among species. A missense mutation in this gene has been potentially linked to microlissencephaly and global developmental delay.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TBA3E

Key Reference: N/A

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: RLSVDYSKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tubulin alpha-3E chain

Protein Size: 450

Purification: Affinity purified

• SKU: AVIARP53516_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53516_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Guinea Pig, Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 112714
• Host: Rabbit
• Conjugate: Conjugated, FITC