TUBG2 Antibody - middle region : FITC

TUBG2 Antibody - middle region : FITC
SKU
AVIARP55345_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUBG2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin gamma-2 chain

Protein Size: 451

Purification: Affinity Purified
More Information
SKU AVIARP55345_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55345_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27175
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×