TUSC1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUSC1

Key Reference: Shan,Z., (2004) Oncogene 23 (39), 6612-6620

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor suppressor candidate gene 1 protein

Protein Size: 212

Purification: Affinity Purified

• SKU: AVIARP54383_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54383_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Pig (Porcine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 286319
• Host: Rabbit
• Conjugate: Conjugated, Biotin