UCHL5IP Antibody - middle region : Biotin

UCHL5IP Antibody - middle region : Biotin
SKU
AVIARP56968_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UCHL5IP

Key Reference: Hahn,Y. Hum. Genet. 119 (1-2), 169-178 (2006)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 427

Purification: Affinity Purified

Subunit: 7
More Information
SKU AVIARP56968_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56968_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55559
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×