Usp12 Antibody - N-terminal region : HRP

Usp12 Antibody - N-terminal region : HRP
SKU
AVIARP55811_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Usp12 is a deubiquitinating enzyme. It has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. It is not involved in deubiquitination of monoubiquitinated FANCD2.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Usp12

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: HSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIAD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin carboxyl-terminal hydrolase 12

Protein Size: 370

Purification: Affinity Purified
More Information
SKU AVIARP55811_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55811_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22217
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×