VPS28 Antibody - N-terminal region : HRP

VPS28 Antibody - N-terminal region : HRP
SKU
AVIARP56850_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway. The encoded protein is one of the three subunits of the ESCRT-I complex (endosomal complexes required for transport) invol

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS28

Key Reference: Hui,E.K., (2006) J. Virol. 80 (5), 2291-2308

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Vacuolar protein sorting-associated protein 28 homolog

Protein Size: 221

Purification: Affinity Purified
More Information
SKU AVIARP56850_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56850_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51160
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×