VPS54 Antibody - N-terminal region : HRP

VPS54 Antibody - N-terminal region : HRP
SKU
AVIARP56168_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi. This gene encodes for a protein that in yeast forms part of a trimeric vacuolar-protein-sorting complex that is required for retrograde transport of proteins from prevacuoles to the late Golgi compartment. As in yeast, mammalian Vps54 proteins contain a coiled-coil region and dileucine motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS54

Key Reference: Liewen,H., (2005) Exp. Cell Res. 306 (1), 24-34

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: FNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVNIAHQISLRS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Vacuolar protein sorting-associated protein 54

Protein Size: 977

Purification: Affinity Purified
More Information
SKU AVIARP56168_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56168_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51542
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×