WDR21A Antibody - middle region : HRP

WDR21A Antibody - middle region : HRP
SKU
AVIARP55298_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR21A

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DDB1- and CUL4-associated factor 4 Ensembl ENSP00000377781

Protein Size: 395

Purification: Affinity Purified
More Information
SKU AVIARP55298_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55298_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26094
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×