WDR51B Antibody - N-terminal region : Biotin

WDR51B Antibody - N-terminal region : Biotin
SKU
AVIARP55620_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: WDR51B contains 7 WD repeats. The function of the WDR51B protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WDR51B

Key Reference: Higa,L.A., (2006) Nat. Cell Biol. 8 (11), 1277-1283

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: POC1 centriolar protein homolog B

Protein Size: 478

Purification: Affinity Purified
More Information
SKU AVIARP55620_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55620_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 282809
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×