WDR53 Antibody - middle region : FITC

WDR53 Antibody - middle region : FITC
SKU
AVIARP55842_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR53

Key Reference: Higa,L.A., (2006) Nat. Cell Biol. 8 (11), 1277-1283

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat-containing protein 53

Protein Size: 358

Purification: Affinity Purified
More Information
SKU AVIARP55842_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55842_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 348793
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×