WDR55 Antibody - middle region : HRP

WDR55 Antibody - middle region : HRP
SKU
AVIARP57011_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: WDR55 is a nucleolar protein that acts as a modulator of rRNA synthesis. WDR55 plays a central role during organogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR55

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: WD repeat-containing protein 55

Protein Size: 383

Purification: Affinity Purified
More Information
SKU AVIARP57011_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57011_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54853
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×