WIPI1 Antibody - N-terminal region : Biotin

WIPI1 Antibody - N-terminal region : Biotin
SKU
AVIARP57075_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI su

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WIPI1

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: AGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat domain phosphoinositide-interacting protein 1

Protein Size: 446

Purification: Affinity Purified
More Information
SKU AVIARP57075_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57075_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55062
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×