XAF1 Antibody - middle region : FITC

XAF1 Antibody - middle region : FITC
SKU
AVIARP56970_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: X-linked inhibitor of apoptosis (XIAP; MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3; M

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human XAF1

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: RSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: XIAP-associated factor 1

Protein Size: 301

Purification: Affinity Purified
More Information
SKU AVIARP56970_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56970_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54739
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×