XRRA1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: XRRA1 may be involved in the response of cells to X-ray radiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human XRRA1

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: X-ray radiation resistance-associated protein 1

Protein Size: 792

Purification: Affinity Purified

• SKU: AVIARP53441_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53441_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 143570
• Host: Rabbit
• Conjugate: Conjugated, Biotin