ZBTB48 Antibody - middle region : HRP

ZBTB48 Antibody - middle region : HRP
SKU
AVIARP58014_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZBTB48 contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to and regulates the J and/or S elements in MHC II promoter.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZBTB48

Key Reference: Maris,J.M., (1997) Eur. J. Cancer 33 (12), 1991-1996

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: EFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger and BTB domain-containing protein 48

Protein Size: 688

Purification: Affinity Purified
More Information
SKU AVIARP58014_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58014_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3104
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×