ZNF675 Antibody - N-terminal region : FITC

ZNF675 Antibody - N-terminal region : FITC
SKU
AVIARP57962_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ZNF675 may be involved in transcriptional regulation. It may play a role during osteoclast differentiation by modulating TRAF6 signaling activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF675

Key Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: CDKYVKVFNKFSHSDRHKIKHMENKPFKCKECGRSFCMLSHLTRHERNYT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 675

Protein Size: 568

Purification: Affinity Purified
More Information
SKU AVIARP57962_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57962_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 171392
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×