ZPBP2 Antibody - middle region : Biotin

ZPBP2 Antibody - middle region : Biotin
SKU
AVIARP53477_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ZPBP2 may be implicated in gamete interaction during fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZPBP2

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zona pellucida-binding protein 2

Protein Size: 315

Purification: Affinity Purified
More Information
SKU AVIARP53477_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53477_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 124626
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×