ZPBP2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZPBP2 may be implicated in gamete interaction during fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZPBP2

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zona pellucida-binding protein 2

Protein Size: 338

Purification: Affinity Purified

• SKU: AVIARP53476_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53476_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 124626
• Host: Rabbit
• Conjugate: Conjugated, HRP