TMEM26 antibody

TMEM26 antibody
SKU
GTX04582-100
Packaging Unit
100 μl
Manufacturer
GeneTex

Availability: loading...
Price is loading...
Calculated MW: 42

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene encodes a protein containing multiple transmembrane helices. It is a selective surface protein marker of brite/beige adipocytes, which may coexist with classical brown adipocytes in brown adipose tissue. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot ID: Q6ZUK4

Antigen Species: Human

Immunogen: A synthetic peptide directed towards the C-terminal region of Human TMEM26 (RSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGLAIPLRGSPVTSDDSH)

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: transmembrane protein 26
More Information
SKU GTX04582-100
Manufacturer GeneTex
Manufacturer SKU GTX04582-100
Package Unit 100 μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Immunohistochemistry (paraffin), Western Blotting
Isotype IgG
Human Gene ID 219623
Host Rabbit
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF)
×